DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rev7 and mdf-2

DIOPT Version :9

Sequence 1:NP_649555.1 Gene:Rev7 / 40677 FlyBaseID:FBgn0037345 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001023563.1 Gene:mdf-2 / 177046 WormBaseID:WBGene00003161 Length:203 Species:Caenorhabditis elegans


Alignment Length:183 Identity:47/183 - (25%)
Similarity:85/183 - (46%) Gaps:25/183 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ADIIVEAMEVLVNHILYVRGIYPSHIFKMKRMYNSPIYVSIFPPLNNYLAGVLKSAQELLRRREL 71
            |.::.|.....:|.|||.|.:|||..||.::.|...::|:....|..::..:|:..:..|.:|:|
 Worm    16 AQLVKEFFHFGLNSILYQRALYPSDSFKREKKYGLTLWVAHEKKLQAFMDPLLQQVEYWLAKRQL 80

  Fly    72 QCLELIVYQ-KENEKLESYKMQLETQRSGLPAED-HLMEFEQNMR----SVIYKISQRLNQAPKL 130
            :.|.:::.: |..|.:|.::..:.|:......|: |.::.|:.:|    .||.:|:..::..|.|
 Worm    81 KRLVMVISEVKTKEVVERWQFDIHTENLAEEGENAHRVKEEKKIRQEISDVIRQITASVSFLPLL 145

  Fly   131 PAGSCQFKVHLHTTQEAFIRFSHDSQYQEFPWLQTQKTESQA----TGRTVYL 179
            .. ...|.|.::|        ..|:|..| .|     |||.|    ...||.|
 Worm   146 EE-PVSFDVLIYT--------GKDTQAPE-DW-----TESGACLIQNSETVQL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rev7NP_649555.1 None
mdf-2NP_001023563.1 HORMA 15..191 CDD:367025 47/183 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1630737at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.