DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2931 and NAM8

DIOPT Version :10

Sequence 1:NP_649552.1 Gene:CG2931 / 40673 FlyBaseID:FBgn0037342 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_011954.1 Gene:NAM8 / 856486 SGDID:S000001128 Length:523 Species:Saccharomyces cerevisiae


Alignment Length:81 Identity:30/81 - (37%)
Similarity:47/81 - (58%) Gaps:1/81 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 IFCGDLGNDVNDEVLTRTF-NKFPSFQRARVVRDKRTGKSKGFGFVSFREPADFIRAMKEMDGRY 263
            ||.|||..:|.:..|...| |::.|...|::|.|:.||.|||:|||.|....:...|:.||.|.:
Yeast   165 IFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQGVF 229

  Fly   264 VGSRPIKLRKSTWRQR 279
            :..|.||:..::.:|:
Yeast   230 LNGRAIKVGPTSGQQQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2931NP_649552.1 RRM_RBM42 192..274 CDD:409817 29/74 (39%)
NAM8NP_011954.1 RRM1_NGR1_NAM8_like 55..144 CDD:410023
RRM2_SECp43_like 162..241 CDD:409781 29/75 (39%)
RRM3_NGR1_NAM8_like 312..383 CDD:409782
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.