DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2931 and PAB8

DIOPT Version :9

Sequence 1:NP_649552.1 Gene:CG2931 / 40673 FlyBaseID:FBgn0037342 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001185184.1 Gene:PAB8 / 841399 AraportID:AT1G49760 Length:671 Species:Arabidopsis thaliana


Alignment Length:168 Identity:46/168 - (27%)
Similarity:77/168 - (45%) Gaps:35/168 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 EEAIKAARASSAL--QSFQTTE------RKKKDRKTVRIAGGTVWE-----DTSLADWPD--DDF 198
            |.:..||||..||  ::|...|      :||.:|:|         |     :.||.:..|  ...
plant   272 ENSDDAARAVDALNGKTFDDKEWFVGKAQKKSERET---------ELKQKFEQSLKEAADKSQGS 327

  Fly   199 RIFCGDLGNDVNDEVLTRTFNKFPSFQRARVVRDKRTGKSKGFGFVSFREPADFIRAMKEMDGRY 263
            .::..:|...|.|:.|...|..|.:....:|:||. :|.|:|.|||:|..|.:..||:.||:|:.
plant   328 NLYVKNLDESVTDDKLREHFAPFGTITSCKVMRDP-SGVSRGSGFVAFSTPEEATRAITEMNGKM 391

  Fly   264 VGSRPIKLRKSTWRQRSLDVVKKKEREKQVLLQAFNSM 301
            :.::|:.:.          :.::||..|..|...|:.|
plant   392 IVTKPLYVA----------LAQRKEDRKARLQAQFSQM 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2931NP_649552.1 RRM_RBM42 192..274 CDD:240829 24/83 (29%)
RRM <194..>280 CDD:223796 24/87 (28%)
PAB8NP_001185184.1 PABP-1234 46..646 CDD:130689 46/168 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.