DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2931 and CG34354

DIOPT Version :9

Sequence 1:NP_649552.1 Gene:CG2931 / 40673 FlyBaseID:FBgn0037342 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster


Alignment Length:203 Identity:51/203 - (25%)
Similarity:86/203 - (42%) Gaps:31/203 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 SKAMSATPVVLSSAPKLYQCRQSVHVP----TVAAAPSIDINAVSFDVTQKLKKLKAEKSGPNPI 147
            |..|...|.:...||   |.....|.|    .:|..|:....|.:....|.:.....:.:|..  
  Fly     5 STLMMPAPTIAMGAP---QITMGPHKPPETKLLAIHPAAAAAAAAQQQQQSVTAAHLQHNGQQ-- 64

  Fly   148 AEEAIKAARASSALQSFQTTERKKKDRKTVRIAGGTVWEDTSLADWPDDDFRIFCGDLGNDVNDE 212
                    :.|...|..|.::::::.::  ::.|.         :...:.|.||.|||..::..:
  Fly    65 --------QHSQQQQQQQMSQQQQQQQQ--QLVGN---------NSKPEQFHIFVGDLSAEIETQ 110

  Fly   213 VLTRTFNKFPSFQRARVVRDKRTGKSKGFGFVSFREPADFIRAMKEMDGRYVGSRPIKLRKSTWR 277
            .|...|..|......|||||.:|.||||:|||||.:.::...|:..|:|:::|||.|   ::.|.
  Fly   111 QLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITAMNGQWLGSRSI---RTNWA 172

  Fly   278 QRSLDVVK 285
            .|.....|
  Fly   173 TRKPPATK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2931NP_649552.1 RRM_RBM42 192..274 CDD:240829 31/81 (38%)
RRM <194..>280 CDD:223796 32/85 (38%)
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 30/76 (39%)
RRM3_TIA1_like 202..278 CDD:240800
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464030
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.