DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2931 and RBMXL1

DIOPT Version :10

Sequence 1:NP_649552.1 Gene:CG2931 / 40673 FlyBaseID:FBgn0037342 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_062556.2 Gene:RBMXL1 / 494115 HGNCID:25073 Length:390 Species:Homo sapiens


Alignment Length:85 Identity:28/85 - (32%)
Similarity:49/85 - (57%) Gaps:3/85 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 ADWPDDDFRIFCGDLGNDVNDEVLTRTFNKFPSFQRARVVRDKRTGKSKGFGFVSFREPADFIRA 255
            ||.|.   ::|.|.|..:.|::.|...|.|:.......:::|:.|.||:||.||:|..|||...|
Human     4 ADRPG---KLFIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFESPADAKDA 65

  Fly   256 MKEMDGRYVGSRPIKLRKST 275
            .::|:|:.:..:.||:.::|
Human    66 ARDMNGKSLDGKAIKVEQAT 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2931NP_649552.1 RRM_RBM42 192..274 CDD:409817 26/81 (32%)
RBMXL1NP_062556.2 RRM_RBMX_like 7..86 CDD:409816 26/82 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 62..390 6/24 (25%)
dnaA 165..>306 CDD:455861
RBM1CTR 173..217 CDD:400429
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.