DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2931 and trv

DIOPT Version :9

Sequence 1:NP_649552.1 Gene:CG2931 / 40673 FlyBaseID:FBgn0037342 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster


Alignment Length:315 Identity:81/315 - (25%)
Similarity:120/315 - (38%) Gaps:113/315 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PARN-LFVP-----NQVRPIIAANTYQNSQHKL--QH------------HQGNGGSRLTVPPPPM 67
            ||:: :|||     .|..|       |..||.|  ||            |      ..:|||||.
  Fly   131 PAQSMIFVPVMLPMQQQHP-------QQQQHDLHMQHPLTPSEDCKPLLH------AKSVPPPPQ 182

  Fly    68 PPPPTFMSTFVPTGSGGGSSKAMSATPVVLSS---APKLYQCRQSVHVPTVAAAPSIDINAVSFD 129
            |||  .::.|          :||...|.:..|   .|:.:.|......|.....|.         
  Fly   183 PPP--MLTHF----------QAMMQPPPLPPSPMMPPQSFGCPLPSRTPATPPLPG--------- 226

  Fly   130 VTQKLKKLKA---------EKSGPNPIAEEAIKAARASSALQSFQT----------------TER 169
             |.:::.||:         :::|..|....|::|...:....||.|                || 
  Fly   227 -TYRVQSLKSAAAAAVSAYQRNGKLPRNLPALRAMEMALRTNSFATPPAPHSLPLPPPHAARTE- 289

  Fly   170 KKKDRKTVRIAGGTVWEDTSLADWPDDD----------FRIFCGDLGNDVNDEVLTRTFNKFPSF 224
                      .||...||:      |::          |.||.|||.:::..:.|...|..|...
  Fly   290 ----------GGGQDMEDS------DEEMEYMPPLHKQFHIFVGDLSSEIETQQLREAFTPFGEI 338

  Fly   225 QRARVVRDKRTGKSKGFGFVSFREPADFIRAMKEMDGRYVGSRPIKLRKSTWRQR 279
            ...|||||.:|.||||:|||||.:.::...|:..|:|:::|||.|   ::.|..|
  Fly   339 SDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQWLGSRSI---RTNWATR 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2931NP_649552.1 RRM_RBM42 192..274 CDD:240829 32/91 (35%)
RRM <194..>280 CDD:223796 34/96 (35%)
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 30/76 (39%)
RRM3_TIA1_like 416..491 CDD:240800
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1221
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.