DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2931 and Syp

DIOPT Version :10

Sequence 1:NP_649552.1 Gene:CG2931 / 40673 FlyBaseID:FBgn0037342 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001262777.1 Gene:Syp / 42460 FlyBaseID:FBgn0038826 Length:761 Species:Drosophila melanogaster


Alignment Length:182 Identity:36/182 - (19%)
Similarity:81/182 - (44%) Gaps:39/182 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 IAEEAIKAARASSALQSFQTTERKKKDR----------KTVRIAG---GT----VWEDTSLADW- 193
            :.||..|.|.....:..:.:.:.|||:|          |...:|.   ||    ||....:.|| 
  Fly   303 LIEEFSKHAPGLYEVIIYSSPDDKKKNRGFCFLEYESHKAASLAKRRLGTGRIKVWGCDIIVDWA 367

  Fly   194 -----PDDDFR-----IFCGDLGNDVNDEVLTRTFNKFPSFQRARVVRDKRTGKSKGFGFVSFRE 248
                 ||:...     ::..:|..||:::.|...|.::...:|.:.::|        :.|:.|.:
  Fly   368 DPQEEPDEQTMSKVKVLYVRNLTQDVSEDKLKEQFEQYGKVERVKKIKD--------YAFIHFED 424

  Fly   249 PADFIRAMKEMDGRYVGSRPIKL---RKSTWRQRSLDVVKKKEREKQVLLQA 297
            ....:.||:.::|:.:|:..|::   :..:.:::..::::.:||....::||
  Fly   425 RDSAVEAMRGLNGKEIGASNIEVSLAKPPSDKKKKEEILRARERRMMQMMQA 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2931NP_649552.1 RRM_RBM42 192..274 CDD:409817 18/95 (19%)
SypNP_001262777.1 NURR_Syncrip-like 68..150 CDD:410953
hnRNP-R-Q 153..>563 CDD:273732 36/182 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.