DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2931 and Rbp4

DIOPT Version :9

Sequence 1:NP_649552.1 Gene:CG2931 / 40673 FlyBaseID:FBgn0037342 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster


Alignment Length:105 Identity:22/105 - (20%)
Similarity:50/105 - (47%) Gaps:16/105 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 RIFCGDLGNDVNDEVLTRTFNKFPSFQRARVVRDKRTGKSKGFGFVSFREPADFIRAMKEMDGRY 263
            |||.|.|....::.::...|::|......:::.|:.||:.:.|||:.|.:|:...:|:..     
  Fly   137 RIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAP----- 196

  Fly   264 VGSRPIKLRKSTWRQRSLDVVKK--KEREKQVLLQAFNSM 301
                     :..|..::|..||:  ::.:::.....|:|:
  Fly   197 ---------RKHWILQTLVEVKRSTQKADRRFRFPIFSSV 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2931NP_649552.1 RRM_RBM42 192..274 CDD:240829 16/74 (22%)
RRM <194..>280 CDD:223796 17/80 (21%)
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621
RRM2_hnRNPA_like 137..209 CDD:240774 18/85 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464031
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.