DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2931 and ssx

DIOPT Version :9

Sequence 1:NP_649552.1 Gene:CG2931 / 40673 FlyBaseID:FBgn0037342 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster


Alignment Length:185 Identity:42/185 - (22%)
Similarity:80/185 - (43%) Gaps:49/185 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 AAPSIDINAVSFDVTQKLKKLKAEKSGPNPIAEEAIKAARASSALQSFQT------------TER 169
            :|.::.||.:..|:|.  ::|....||..||        .....::.|:|            ||.
  Fly    91 SATNLIINYLPQDMTD--RELYNLFSGCGPI--------NTCKIMRDFKTGYSFGYGFVDYKTES 145

  Fly   170 KKKD-----------RKTVRIA----GGTVWEDTSLADWPDDDFRIFCGDLGNDVNDEVLTRTFN 219
            ..:|           .|.::::    ||...:||:|          :..:|..::||::|.|.|:
  Fly   146 DSEDAIQKLNGFYVRNKRLKVSYARPGGQSIKDTNL----------YVINLSRNINDDMLDRIFS 200

  Fly   220 KFPSFQRARVVRDKRTGKSKGFGFVSFREPADFIRAMKEMDGRYV--GSRPIKLR 272
            .:....:..::|||.||:.:|..||.:.:..:...|:|.::....  ||:||.:|
  Fly   201 PYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2931NP_649552.1 RRM_RBM42 192..274 CDD:240829 21/83 (25%)
RRM <194..>280 CDD:223796 21/81 (26%)
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 15/89 (17%)
RRM_SF 179..257 CDD:302621 23/87 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.