DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2931 and Rbmy

DIOPT Version :10

Sequence 1:NP_649552.1 Gene:CG2931 / 40673 FlyBaseID:FBgn0037342 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_035383.2 Gene:Rbmy / 19657 MGIID:104732 Length:380 Species:Mus musculus


Alignment Length:89 Identity:32/89 - (35%)
Similarity:50/89 - (56%) Gaps:1/89 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 RIFCGDLGNDVNDEVLTRTFNKFPSFQRARVVRDKRTGKSKGFGFVSFREPADFIRAMKEMDGRY 263
            :||.|.|......:.|...|.:|....|..::||:.|.||:||.|::||..||...|:|||:|..
Mouse     9 KIFIGGLNIKTRQKTLQEIFGRFGPVARVILMRDRETKKSRGFAFLTFRRLADAKNAVKEMNGVI 73

  Fly   264 VGSRPIKLRKSTWRQRSLDVVKKK 287
            :..:.||::::. |..||:...||
Mouse    74 LDGKRIKVKQAR-RPSSLESGSKK 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2931NP_649552.1 RRM_RBM42 192..274 CDD:409817 27/74 (36%)
RbmyNP_035383.2 RRM_SF 7..86 CDD:473069 27/77 (35%)
PABP-1234 <10..207 CDD:130689 32/88 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..226 5/16 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 279..358
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.