DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2931 and Rbmxl1

DIOPT Version :9

Sequence 1:NP_649552.1 Gene:CG2931 / 40673 FlyBaseID:FBgn0037342 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001239018.1 Gene:Rbmxl1 / 19656 MGIID:1343045 Length:388 Species:Mus musculus


Alignment Length:85 Identity:28/85 - (32%)
Similarity:49/85 - (57%) Gaps:3/85 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 ADWPDDDFRIFCGDLGNDVNDEVLTRTFNKFPSFQRARVVRDKRTGKSKGFGFVSFREPADFIRA 255
            ||.|.   ::|.|.|..:.|::.|...|.|:.......:::|:.|.||:||.||:|..|||...|
Mouse     4 ADRPG---KLFIGGLNTETNEKALEAVFGKYGRIVEILLMKDRETNKSRGFAFVTFESPADAKDA 65

  Fly   256 MKEMDGRYVGSRPIKLRKST 275
            .::|:|:.:..:.||:.::|
Mouse    66 ARDMNGKSLDGKAIKVEQAT 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2931NP_649552.1 RRM_RBM42 192..274 CDD:240829 26/81 (32%)
RRM <194..>280 CDD:223796 26/82 (32%)
Rbmxl1NP_001239018.1 RRM_RBMX_like 7..86 CDD:409816 26/82 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..388 9/27 (33%)
RBM1CTR 170..214 CDD:400429
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0226
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.