DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2931 and rbm-42

DIOPT Version :9

Sequence 1:NP_649552.1 Gene:CG2931 / 40673 FlyBaseID:FBgn0037342 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_498090.1 Gene:rbm-42 / 175700 WormBaseID:WBGene00021901 Length:302 Species:Caenorhabditis elegans


Alignment Length:334 Identity:122/334 - (36%)
Similarity:173/334 - (51%) Gaps:83/334 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NIEDELSRFEAEIS----------KPPARNLFVPNQVRPIIAANTYQNSQHKLQHHQGNGGSRLT 61
            |::|||:.||:|::          :|.:....|......|.|..|...|.......|....|.|.
 Worm     3 NLDDELALFESELAELEQASSNSEEPASSQTHVGYDNATISAGPTTSESSAATSSAQVIQPSLLA 67

  Fly    62 VPP---------------------PPMPPPPTFMSTFVPTGSGGGSSKAMSATPVVLSSAPKLYQ 105
            .||                     |.|||.|.  |.|:|        ..:.|.|::.  .|::. 
 Worm    68 APPFIPIAATIAVSPFINPALGRLPTMPPVPP--SIFMP--------PQLRAAPIMF--PPRVL- 119

  Fly   106 CRQSVHVP-TVAAAPSIDINAVSFDVTQKLKKLKAEKSGPNPIAEEAIKAARASSALQS------ 163
               .:..| |:..||::                 .|....|.|.:|.::    :.||||      
 Worm   120 ---GIPAPATIEGAPAL-----------------YETPAVNAIPQELLR----TQALQSDIDKMN 160

  Fly   164 --FQTTERKKK------DRKTVRIAGGTVWEDTSLADWPDDDFRIFCGDLGNDVNDEVLTRTFNK 220
              .||...|||      .:|.||..||.||||.|||:|.::|||:|||||||:|:||:|.:.|.|
 Worm   161 FKKQTDPFKKKIKEQQAKKKFVRSGGGQVWEDPSLAEWDENDFRVFCGDLGNEVSDELLAKAFRK 225

  Fly   221 FPSFQRARVVRDKRTGKSKGFGFVSFREPADFIRAMKEMDGRYVGSRPIKLRKSTWRQRSLDVVK 285
            :||||:|:|||:.||.||||:||||||:..|::|||:||||:|||:||||||||.|::|::||:|
 Worm   226 YPSFQKAKVVRESRTNKSKGYGFVSFRDSEDYVRAMREMDGKYVGNRPIKLRKSAWKERNIDVIK 290

  Fly   286 KKEREKQVL 294
            :|.::|:.|
 Worm   291 QKRKQKKEL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2931NP_649552.1 RRM_RBM42 192..274 CDD:240829 54/81 (67%)
RRM <194..>280 CDD:223796 56/85 (66%)
rbm-42NP_498090.1 RRM_RBM42 197..279 CDD:240829 54/81 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167845
Domainoid 1 1.000 114 1.000 Domainoid score I3805
eggNOG 1 0.900 - - E1_KOG0226
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 187 1.000 Inparanoid score I2595
Isobase 1 0.950 - 0 Normalized mean entropy S1221
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249623at2759
OrthoFinder 1 1.000 - - FOG0005503
OrthoInspector 1 1.000 - - oto17697
orthoMCL 1 0.900 - - OOG6_103065
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1762
SonicParanoid 1 1.000 - - X3922
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.640

Return to query results.
Submit another query.