DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2931 and G3bp1

DIOPT Version :9

Sequence 1:NP_649552.1 Gene:CG2931 / 40673 FlyBaseID:FBgn0037342 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_598249.1 Gene:G3bp1 / 171092 RGDID:621140 Length:465 Species:Rattus norvegicus


Alignment Length:309 Identity:69/309 - (22%)
Similarity:109/309 - (35%) Gaps:79/309 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EAEISKPPARNLFVPNQVRPIIAAN---TY--QNSQHKLQHHQGNGGSRLTVPPPPMPPPPTFMS 75
            |.|:.:|..|      |..|.:.|:   |:  |...:.|:.|.    ....|.|.|.|.|.    
  Rat   150 EEEVEEPEER------QQSPEVVADDSGTFYDQTVSNDLEEHL----EEPVVEPEPEPEPE---- 200

  Fly    76 TFVPTGSGGGSSKAMSATPVVLSSAPKLYQCRQSVHVPTVAAAPSIDINAVSF-DVTQK------ 133
               |........:.....|.:..:||:..| :.:...|...|....|:...|: .||.|      
  Rat   201 ---PEPEPVSDIQEDKPEPALEEAAPEDVQ-KSASPAPADVAPAQEDLRTFSWASVTSKNLPPSG 261

  Fly   134 ----------LKKLKAEKSGPNPIAEEAIKAARASSALQSFQTTERKKKDR---------KTVRI 179
                      :.|:.|.:..|....:..|...|.       |..:|.::.|         :.:|.
  Rat   262 AVPVTGTPPHVVKVPASQPRPESKPDSQIPPQRP-------QRDQRAREQRINIPPQRGPRPIRE 319

  Fly   180 AG--GTVWEDTSLADWPDDDFRIFCGDLGNDVNDEVLTRTFNKFPSFQRARVVRDKRTGKSKGFG 242
            ||  |.| |...:...| |..::|.|:|.::|:...|...|..:.:....|:   ...||...||
  Rat   320 AGEPGDV-EPRRMVRHP-DSHQLFIGNLPHEVDKSELKDFFQSYGNVVELRI---NSGGKLPNFG 379

  Fly   243 FVSF--REPADFIRAMKEMDGRYVGSRPIKLRKSTWRQRSLDVVKKKER 289
            ||.|  .||..          :.:.:|||..|.:.    .|:|.:||.|
  Rat   380 FVVFDDSEPVQ----------KVLNNRPIMFRGAV----RLNVEEKKTR 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2931NP_649552.1 RRM_RBM42 192..274 CDD:240829 22/83 (27%)
RRM <194..>280 CDD:223796 22/87 (25%)
G3bp1NP_598249.1 NTF2 7..135 CDD:238403
PHA03247 <216..328 CDD:223021 24/120 (20%)
RRM_G3BP1 335..414 CDD:409896 26/96 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.