DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG2931 and RBMXL3

DIOPT Version :9

Sequence 1:	NP_649552.1	Gene:	CG2931 / 40673	FlyBaseID:	FBgn0037342	Length:	302	Species:	Drosophila melanogaster
Sequence 2:	NP_001138818.1	Gene:	RBMXL3 / 139804	HGNCID:	26859	Length:	1067	Species:	Homo sapiens

Alignment Length:	94	Identity:	28/94 - (29%)
Similarity:	51/94 - (54%)	Gaps:	11/94 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   191 ADWPDDDFRIFCGDLGNDVNDEVLTRTFNKFPSFQRARVVRDKRTGKSKGFGFVSFREPADFIRA 255
            ||.|:   ::|.|.|....:::.|...|.|:....:..:::|::|.||:||.||:|..|||...|
Human     4 ADRPE---KLFIGGLNLKTDEKALKAEFGKYGHIIKVFLMKDRKTNKSRGFAFVTFESPADAKAA 65

  Fly   256 MKEMDGRYVGSRPIKL--------RKSTW 276
            .::|:|:|:..:.|.:        :.|.|
Human    66 ARDMNGKYLDGKAIMVAQTIKPAFKSSRW 94

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG2931	NP_649552.1	RRM_RBM42	192..274	CDD:240829	25/89 (28%)
CG2931	NP_649552.1	RRM	<194..>280	CDD:223796	26/91 (29%)
RBMXL3	NP_001138818.1	RRM	<1..>81	CDD:223796	26/79 (33%)
		RRM_RBMX_like	7..86	CDD:240828	24/81 (30%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	90..131		2/5 (40%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	144..175
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	267..305
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	357..1067
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0226
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900