DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2931 and Gm10352

DIOPT Version :9

Sequence 1:NP_649552.1 Gene:CG2931 / 40673 FlyBaseID:FBgn0037342 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001257440.1 Gene:Gm10352 / 100042881 MGIID:3708825 Length:380 Species:Mus musculus


Alignment Length:93 Identity:33/93 - (35%)
Similarity:51/93 - (54%) Gaps:1/93 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 DDDFRIFCGDLGNDVNDEVLTRTFNKFPSFQRARVVRDKRTGKSKGFGFVSFREPADFIRAMKEM 259
            |...:||.|.|......:.|...|.:|....|..::||:.|.||:||.|::||..||...|:|||
Mouse     5 DQPGKIFIGGLNIKTRQKTLQEIFGRFGPVARVILMRDRETKKSRGFAFLTFRRLADAKNAVKEM 69

  Fly   260 DGRYVGSRPIKLRKSTWRQRSLDVVKKK 287
            :|..:..:.||::::. |..||:...||
Mouse    70 NGVILDGKRIKVKQAR-RPSSLESGSKK 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2931NP_649552.1 RRM_RBM42 192..274 CDD:240829 28/78 (36%)
RRM <194..>280 CDD:223796 29/84 (35%)
Gm10352NP_001257440.1 RRM <3..>85 CDD:223796 28/79 (35%)
RRM_SF 7..86 CDD:302621 27/79 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0226
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.