DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and ynbD

DIOPT Version :10

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_415929.1 Gene:ynbD / 945985 ECOCYCID:G6730 Length:430 Species:Escherichia coli


Alignment Length:248 Identity:47/248 - (18%)
Similarity:75/248 - (30%) Gaps:92/248 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 VLLVITFF-----KLETMTAFKREIHEEELWLYKNPRRPDIVRGGELLFWVIVAPFLV-TIAFYW 137
            :||:..||     .|...||. ::::..::        |..|.|     |....|||. ||..||
E. coli     8 LLLLAPFFFFTYGSLNQFTAV-QDLNSHDI--------PSQVFG-----WETAIPFLPWTIVPYW 58

  Fly   138 YT---------------RDRRDFRAASWAWTLALCMNGIPTSVLKITVGRPRPDYFYRCFPDGVM 187
            ..               ..||.......|..:|.|  |.....||.:..||              
E. coli    59 SLDLLYGFSLFVCSTTFEQRRLVHRLILATVMACC--GFLLYPLKFSFIRP-------------- 107

  Fly   188 VLNTTSNGVDTSILDFNCTGLPGDINEGRKSF-------PSGHSSFAFASFGFIAYYIGAKLHAF 245
                            ..:|:.|.:....:.|       ||.|....:..:.....::..:    
E. coli   108 ----------------EVSGVTGWLFSQLELFDLPYNQSPSLHIILCWLLWRHFRQHLAER---- 152

  Fly   246 DSRGRGHTWR-LCIAVIPLFIALLVAVSRTCDYHHHWQDVTIGGLIGLFAGYI 297
                    || :|....     ||:|:|....:.||:.||..|..:|:...::
E. coli   153 --------WRKVCGGWF-----LLIAISTLTTWQHHFIDVITGLAVGMLIDWM 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 40/218 (18%)
ynbDNP_415929.1 PAP2_Aur1_like 47..197 CDD:239481 36/195 (18%)
DSP_bac 295..429 CDD:350376
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.