DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and PLPP3

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_003704.3 Gene:PLPP3 / 8613 HGNCID:9229 Length:311 Species:Homo sapiens


Alignment Length:260 Identity:62/260 - (23%)
Similarity:103/260 - (39%) Gaps:73/260 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 DSSSVQPEKR------EERSH--RTGNS-NAKLSDAVDVVLRVLLVIT--FFKLETMTAFKREIH 99
            ::|:::|..|      |...:  :||.: |..:..||.:|:.:|.:||  |:::..:...:..|.
Human    55 ETSTIKPYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQ 119

  Fly   100 EEEL-WLYKNPRRPDIVRGGELLFWVIVAPFLVTIAFYWYTRDRRDFRAASWAWTLALCMNGIPT 163
            ...: .|||.                 |..||...|.      .:.|                 |
Human   120 NPYVAALYKQ-----------------VGCFLFGCAI------SQSF-----------------T 144

  Fly   164 SVLKITVGRPRPDYFYRCFPDGVMVLNTTSNGVDTSILDFNCTGLPGDINEGRKSFPSGHSSFAF 228
            .:.|:::||.||.:...|.||...:     |..:..|.::.|.|....:.|.||||.|||:||:.
Human   145 DIAKVSIGRLRPHFLSVCNPDFSQI-----NCSEGYIQNYRCRGDDSKVQEARKSFFSGHASFSM 204

  Fly   229 ASFGFIAYYIGAKLHAFDSRGRGHTWRLCIAVIPL------FIALLVAVSRTCDYHHHWQDVTIG 287
            .:..::..|:.|:.          |||....:.||      .:|....:||..|:.||..||..|
Human   205 YTMLYLVLYLQARF----------TWRGARLLRPLLQFTLIMMAFYTGLSRVSDHKHHPSDVLAG 259

  Fly   288  287
            Human   260  259

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 47/190 (25%)