DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and LCB3

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_012401.1 Gene:LCB3 / 853307 SGDID:S000003670 Length:409 Species:Saccharomyces cerevisiae


Alignment Length:98 Identity:22/98 - (22%)
Similarity:35/98 - (35%) Gaps:26/98 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 PSGHSSFAFASFGFIAYYIGAKLHAFDSRGRGHTWR---------LCIAVIPLFIALLVAVSRTC 275
            ||.|::.|........|.|               ||         |.::.:.||..:.:...|..
Yeast   157 PSSHTANATGVSLLFLYNI---------------WRMQESSVMVQLLLSCVVLFYYMTLVFGRIY 206

  Fly   276 DYHHHWQDVTIGGLIGLFAGYI-SYTQY-YPSI 306
            ...|...|:..|||||:....: .|.:| :|.:
Yeast   207 CGMHGILDLVSGGLIGIVCFIVRMYFKYRFPGL 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 20/91 (22%)
LCB3NP_012401.1 PAP2_SPPase1 77..230 CDD:239482 19/87 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.