DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and LPP1

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_010791.3 Gene:LPP1 / 852114 SGDID:S000002911 Length:274 Species:Saccharomyces cerevisiae


Alignment Length:155 Identity:50/155 - (32%)
Similarity:71/155 - (45%) Gaps:37/155 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 LALCMNGIPTSVLKITVGRPRPDYFYRCFPD------------GVMVLNTTSNGVDTSILDFNCT 206
            |.:.:|...|..||:.:|..|||:..||.||            |:.:...|:..:          
Yeast   123 LIISINAALTGALKLIIGNLRPDFVDRCIPDLQKMSDSDSLVFGLDICKQTNKWI---------- 177

  Fly   207 GLPGDINEGRKSFPSGHSSFAFASFGFIAYYIGAKLHAFDSRGRGHTWRLCIAVIPLFIALLVAV 271
                 :.||.||.|||||||..::.||.  |:..::  |.:|..    |.|| ..|| :||:|.|
Yeast   178 -----LYEGLKSTPSGHSSFIVSTMGFT--YLWQRV--FTTRNT----RSCI-WCPL-LALVVMV 227

  Fly   272 SRTCDYHHHWQDVTIGGLIGLFAGY 296
            ||..|:.|||.||..|.::.....|
Yeast   228 SRVIDHRHHWYDVVSGAVLAFLVIY 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 50/155 (32%)
LPP1NP_010791.3 PAP2_containing_1_like 52..258 CDD:239484 50/155 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001532
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 1 1.100 - - O PTHR10165
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3374
SonicParanoid 1 1.000 - - X622
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.