DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and LPP4

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_566602.1 Gene:LPP4 / 821350 AraportID:AT3G18220 Length:308 Species:Arabidopsis thaliana


Alignment Length:293 Identity:96/293 - (32%)
Similarity:145/293 - (49%) Gaps:29/293 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 DVVLRVLLVITFFKLETMTAFKREIHEEELWLYKNPRRPDIVRGGELLFWVIVAPFLVTIAFYWY 138
            |.::.|:|.:....|..:..|.|.|..:.|.....|...|.:....:....|:.|..:.|.:|:|
plant    25 DWLILVVLGLIDIVLNVIEPFHRYIGPDMLTDLTFPFYEDTIPMWAVPIICILVPICIFIVYYYY 89

  Fly   139 TRDRRDFRAASWAWTLALCMNGIPTSVLKITVGRPRPDYFYRCFPDGVMVLNTTSNGVDTSILDF 203
            .||..|...|......:..:.|:.|..:|..||||||::||||||:|....:.     ||.  |.
plant    90 RRDVYDLHHAILGIGFSCLVTGVTTDSIKDAVGRPRPNFFYRCFPNGKPKFHP-----DTK--DV 147

  Fly   204 NCTGLPGDINEGRKSFPSGHSSFAFASFGFIAYYIGAKLHAFDSRGRGHTWRLCIAVIPLFIALL 268
            .|.|:...|.||.|||||||:|::||...|:|:|:..|:..||.  |||..:||:..:|:.|::|
plant   148 VCHGVKKIIKEGYKSFPSGHTSWSFAGLTFLAWYLSGKIKVFDR--RGHVAKLCLVFLPILISIL 210

  Fly   269 VAVSRTCDYHHHWQDVTIGGLIGLFAGYISYTQYYP-----SIFCPDAGIPLVRWPS-------- 320
            :.:||..||.|||.||..|.:||:|....||..::|     :.:.|.|...::...|        
plant   211 IGISRVDDYWHHWTDVFAGAIIGIFVASFSYLHFFPYPYDENGWAPHAYFRMLAERSTGRATTMT 275

  Fly   321 REGSQYQRLSGKD---DNGSRGPH--HLDGGDA 348
            |.||  :.:.|.|   .|.:..||  |.:..|:
plant   276 RTGS--RGMLGNDVEPGNSASSPHDRHRESTDS 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 74/197 (38%)
LPP4NP_566602.1 PgpB 23..246 CDD:223743 82/229 (36%)
PAP2_containing_1_like 55..244 CDD:239484 74/197 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 145 1.000 Domainoid score I1473
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 174 1.000 Inparanoid score I1509
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 1 1.000 - - FOG0001532
OrthoInspector 1 1.000 - - otm2573
orthoMCL 1 0.900 - - OOG6_100228
Panther 1 1.100 - - O PTHR10165
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X622
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.