| Sequence 1: | NP_649551.4 | Gene: | CG12746 / 40672 | FlyBaseID: | FBgn0037341 | Length: | 363 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_109675.1 | Gene: | Sgpp1 / 81535 | MGIID: | 2135760 | Length: | 430 | Species: | Mus musculus |
| Alignment Length: | 207 | Identity: | 40/207 - (19%) |
|---|---|---|---|
| Similarity: | 57/207 - (27%) | Gaps: | 85/207 - (41%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 118 GELLFWVIVAPFLVTIAFYWYTRDRRDFRAASWAWTLALCMNGIPTSVLKITVGRPRP------- 175
Fly 176 -DYFYRCFPDGVMVLNTTSNGVDTSILDFNCTGLPGDINEGRKSFPSGH--SSFAFASFGFIAYY 237
Fly 238 IGAKLHAFDSRGRGHTWRLCIAVIPLFIAL--------LVAVSRTCDYHHHWQDVTIGGLIGLFA 294
Fly 295 GYISYTQYYPSI 306 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG12746 | NP_649551.4 | PAP2_containing_1_like | 104..302 | CDD:239484 | 38/201 (19%) |
| Sgpp1 | NP_109675.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 34..103 | ||
| PgpB | <117..273 | CDD:223743 | 40/207 (19%) | ||
| PAP2_SPPase1 | 117..264 | CDD:239482 | 38/202 (19%) | ||
| Phosphatase sequence motif I. /evidence=ECO:0000305 | 167..175 | 1/11 (9%) | |||
| Phosphatase sequence motif II. /evidence=ECO:0000305 | 194..197 | 2/2 (100%) | |||
| Phosphatase sequence motif III. /evidence=ECO:0000305 | 237..248 | 3/10 (30%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0671 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||