Sequence 1: | NP_649551.4 | Gene: | CG12746 / 40672 | FlyBaseID: | FBgn0037341 | Length: | 363 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_109675.1 | Gene: | Sgpp1 / 81535 | MGIID: | 2135760 | Length: | 430 | Species: | Mus musculus |
Alignment Length: | 207 | Identity: | 40/207 - (19%) |
---|---|---|---|
Similarity: | 57/207 - (27%) | Gaps: | 85/207 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 118 GELLFWVIVAPFLVTIAFYWYTRDRRDFRAASWAWTLALCMNGIPTSVLKITVGRPRP------- 175
Fly 176 -DYFYRCFPDGVMVLNTTSNGVDTSILDFNCTGLPGDINEGRKSFPSGH--SSFAFASFGFIAYY 237
Fly 238 IGAKLHAFDSRGRGHTWRLCIAVIPLFIAL--------LVAVSRTCDYHHHWQDVTIGGLIGLFA 294
Fly 295 GYISYTQYYPSI 306 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12746 | NP_649551.4 | PAP2_containing_1_like | 104..302 | CDD:239484 | 38/201 (19%) |
Sgpp1 | NP_109675.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 34..103 | ||
PgpB | <117..273 | CDD:223743 | 40/207 (19%) | ||
PAP2_SPPase1 | 117..264 | CDD:239482 | 38/202 (19%) | ||
Phosphatase sequence motif I. /evidence=ECO:0000305 | 167..175 | 1/11 (9%) | |||
Phosphatase sequence motif II. /evidence=ECO:0000305 | 194..197 | 2/2 (100%) | |||
Phosphatase sequence motif III. /evidence=ECO:0000305 | 237..248 | 3/10 (30%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0671 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |