DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and PLPPR3

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_079164.1 Gene:PLPPR3 / 79948 HGNCID:23497 Length:746 Species:Homo sapiens


Alignment Length:244 Identity:57/244 - (23%)
Similarity:89/244 - (36%) Gaps:55/244 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 LCMNGIPTSVLKITVGRPRPDYFYRCFPDGVMVLNTTSNGVDTSILDFNCTGLPGDIN---EGRK 217
            ||...:.|.|:::..|...|.:...|.|:  ..|..||..|:..|....|:|  .||:   ..||
Human   141 LCATALVTDVIQLATGYHTPFFLTVCKPN--YTLLGTSCEVNPYITQDICSG--HDIHAILSARK 201

  Fly   218 SFPSGHSSFAFASFGFIAYYIGAK--LHA-----FDSRGR-----------------GHTWRLCI 258
            :|||.|::.:    .|.|.|:...  .|.     ..:||.                 ..|.:|..
Human   202 TFPSQHATLS----AFAAVYVSVSPAPHCPSQALLLTRGEPSLTPTPMPQMYFNSVISDTTKLLK 262

  Fly   259 AVIPLFIALLVAV---SRTCDYHHHWQDVTIGGLIGLFAGYISYTQYYP--SIFCPDAGIPLVRW 318
            .::....|:...|   ::...|..|..||..|.|||  ||..:|...:.  :...|.|..|....
Human   263 PILVFAFAIAAGVCGLTQITQYRSHPVDVYAGFLIG--AGIAAYLACHAVGNFQAPPAEKPAAPA 325

  Fly   319 PSREG----------SQYQRLSGKDDNGSRGPHHLDGGDAVRRPLLADK 357
            |:::.          |.||:......:....|..|:|..   ||:..:|
Human   326 PAKDALRALTQRGHDSVYQQNKSVSTDELGPPGRLEGAP---RPVAREK 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 44/175 (25%)
PLPPR3NP_079164.1 PAP2_wunen 129..306 CDD:239479 44/174 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144696
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.