DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and Plppr5

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001292380.1 Gene:Plppr5 / 75769 MGIID:1923019 Length:321 Species:Mus musculus


Alignment Length:269 Identity:61/269 - (22%)
Similarity:100/269 - (37%) Gaps:65/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DEMWRNELAMNTDSSSVQPEKREERSHRTGNSNAKLSDAVDVVLRVLLVITFFKLETMTAFKREI 98
            |..:|.......|||:|.|...           ..|:..|.|::.::.....|.|:..|   |:.
Mouse    47 DSAYRKPYPGPEDSSAVPPVLL-----------YSLAAGVPVLVIIVGETAVFCLQLAT---RDF 97

  Fly    99 HEEELWL------YKNPRRPDIVRGGELLFWVIVAPFLVTIAFYWYTRDRRDFRAASWAWTLALC 157
            ..:|..:      |.||.....||            ||...||..:..|                
Mouse    98 ENQEKTILTGDCCYINPLVRRTVR------------FLGIYAFGLFATD---------------- 134

  Fly   158 MNGIPTSVLKITVGRPRPDYFYRCFPDGVMVLNTTSNGVD--TSIL--DFNCTGLPGDINEGRKS 218
               |..:..::..|...|.:...|.|      |.|:.|..  |..:  :..|||.|..|...||:
Mouse   135 ---IFVNAGQVVTGNLAPHFLALCKP------NYTALGCQQYTQFISGEEACTGNPDLIMRARKT 190

  Fly   219 FPSGHSSFAFASFGFIAYYIGAKLHAFDSRGRGHTWRLCIAVIPLFIALLVAVSRTCDYHHHWQD 283
            |||..::.:..:..::..||.:.:.|..:|.....  ||:.:  :.:|.|..::|..:|.:||.|
Mouse   191 FPSKEAALSVYAATYLTMYITSTIKAKGTRLAKPV--LCLGL--MCLAFLTGLNRVAEYRNHWSD 251

  Fly   284 VTIGGLIGL 292
            |..|.|:|:
Mouse   252 VIAGFLVGI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 46/199 (23%)
Plppr5NP_001292380.1 PAP2_wunen 118..267 CDD:239479 43/184 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834806
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.