DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and Plpp1

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_038958986.1 Gene:Plpp1 / 64369 RGDID:621832 Length:299 Species:Rattus norvegicus


Alignment Length:276 Identity:72/276 - (26%)
Similarity:113/276 - (40%) Gaps:60/276 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 NTDSSSVQPEKREERSHRTGNSNAKLSDAVDVVLRVLLVITFFKLETMTAFKREI---HEEELWL 105
            ||..|::.|...:         |.|::|...:...:|       ....|.|:|.:   .|...:.
  Rat    17 NTADSALCPYLTD---------NFKINDYPGLPFIIL-------TSRHTPFQRGVFCTDESIKYP 65

  Fly   106 YKNPRRPDIVRGGELLFWVIVAPFLV-------TIAFYWYTRDRRDFRAASWAWTLALCMNGI-- 161
            |:....|..:.||      ||.||.:       |::.|:.......|.:..:..|:...:...  
  Rat    66 YREDTIPYALLGG------IVIPFCIIVMITGETLSVYFNVLHSNSFVSNHYIATIYKAVGAFLF 124

  Fly   162 -------PTSVLKITVGRPRPDYFYRCFPDGVMVLNTTSNGVDTSILDFNCTGLPGDINEGRKSF 219
                   .|.:.|.::||.||.:...|.||...:     |..|..|.:|.|.|....:.|||.||
  Rat   125 GASASQSLTDIAKYSIGRLRPHFLAVCNPDWSKI-----NCSDGYIENFVCQGNEQKVREGRLSF 184

  Fly   220 PSGHSSFAFASFGFIAYYIGAKLHAFDSRGRGHTWRLCIAVIP---LFIALLVAVSRTCDYHHHW 281
            .||||||:.....|:|.|:.|::       :|...||...::.   :.:::.|.:||..||.|||
  Rat   185 YSGHSSFSMYCMLFVALYLQARM-------KGDWARLLRPMLQFGLVALSIYVGLSRVSDYKHHW 242

  Fly   282 QDVTIGGLIGLFAGYI 297
            .||    ||||..|.:
  Rat   243 SDV----LIGLIQGAV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 60/213 (28%)
Plpp1XP_038958986.1 PAP2_wunen 115..260 CDD:239479 48/156 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338336
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.640

Return to query results.
Submit another query.