DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and LOC571722

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_009295825.1 Gene:LOC571722 / 571722 -ID:- Length:746 Species:Danio rerio


Alignment Length:284 Identity:61/284 - (21%)
Similarity:109/284 - (38%) Gaps:74/284 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VDVVLRVLLVITFFKLETMTAFKR-----EIHEEELWL-YKNPRRPDIVRGGELLFWVIVAPFLV 131
            |::.|.|..|::.:.||....||.     ..|:..|.| |.:|.. :::....||.....||.:.
Zfish    25 VELPLLVSSVVSVYFLEWTDIFKPVRWGFSCHDRSLSLPYIDPTH-EVIPFLMLLSLAFAAPAIT 88

  Fly   132 T-----IAFYWYTRDR------RDFRAASWAW--------------TLALCMNGIPTSVLKITVG 171
            .     |.|...:|.:      .|..||...:              ...||:..:.|.:::::.|
Zfish    89 IMIGEGILFCCLSRAQCGGGAEADINAAGCNFNSFVRRGVRFVGVHVFGLCVTALITDIIQLSTG 153

  Fly   172 RPRPDYFYRCFP----------DGVMVLNTTSNGVDTSILDFNCTGLPGDINEGRKSFPSGHSSF 226
            .|.|.:...|.|          :...:|....:|.|.::           ||..||||||.|::.
Zfish   154 YPAPYFLTVCKPNYTHLNTSCEESFFILEDICSGPDAAL-----------INASRKSFPSQHATL 207

  Fly   227 AFASFGFIAYYIGAKLHAFDSRGRGHTWRLCIAVIPLFI------ALLVAVSRTCDYHHHWQDVT 285
            |..:..:::.|..:.|  .||..         .:.||.:      |::..::|...:.:|..||.
Zfish   208 ASFAAVYVSMYFNSTL--TDSSK---------LLKPLLVFSFIICAIICGLTRIIQHKNHAIDVY 261

  Fly   286 IGGLIG----LFAGYISYTQYYPS 305
            :|.|:|    ::.|..:...:.||
Zfish   262 LGFLLGGGIAVYLGLFAVGNFQPS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 49/243 (20%)
LOC571722XP_009295825.1 PgpB 65..293 CDD:223743 49/244 (20%)
PAP2_wunen 126..275 CDD:239479 35/170 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577806
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.