DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and Dolpp1

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_065062.1 Gene:Dolpp1 / 57170 MGIID:1914093 Length:238 Species:Mus musculus


Alignment Length:216 Identity:52/216 - (24%)
Similarity:82/216 - (37%) Gaps:55/216 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 GELLFWVIVAPFLVTIAFYWYTRDRRDFRAASWAWTLALCMNGIPTSVLKITVGRPRPDYFYRCF 182
            |.||.::.::|..|.:.|......:|:....|:...|||  |.....::|..:..|||     | 
Mouse    30 GHLLAYLSLSPIFVVVGFLTLIIFKRELHTISFLGGLAL--NQGVNWLIKHVIQEPRP-----C- 86

  Fly   183 PDGVMVLNTTSNGVDTSILDFNCTGLPGDINEGRK-SFPSGHSSFA--FASFGFIAYYIGAKLH- 243
                       .|..|::              |.| ..||.||.|.  |:.:.|:..|:  ::| 
Mouse    87 -----------GGPHTAV--------------GTKYGMPSSHSQFMWFFSVYSFLFLYL--RMHQ 124

  Fly   244 AFDSRGRGHTWRLCIAVIPLFIALLVAVSRTCDYHHHWQDVTIGGLIG--LFAGYISYTQ----- 301
            ..::|.....||..:::..|..|.||:.||....:|.|..|..||:.|  :...:...||     
Mouse   125 TNNARFLDLLWRHVLSLGLLTAAFLVSYSRVYLLYHTWSQVFYGGVAGSLMAVAWFIITQEILTP 189

  Fly   302 YYPSIFCPDAGIPLVRWPSRE 322
            .:|.|         ..||..|
Mouse   190 LFPRI---------AAWPISE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 47/194 (24%)
Dolpp1NP_065062.1 PgpB 9..184 CDD:223743 45/188 (24%)
PAP2_dolichyldiphosphatase 16..180 CDD:239477 45/184 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.