DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and plppr2b

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_005165778.2 Gene:plppr2b / 571463 ZFINID:ZDB-GENE-121030-5 Length:358 Species:Danio rerio


Alignment Length:200 Identity:49/200 - (24%)
Similarity:72/200 - (36%) Gaps:55/200 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 KITVGRPRPDYFYRCFPDGVMVLNTTSNGVDTSILDFN----CTGLPGDINEGRKSFPSGHSSFA 227
            ::..|...|.:...|.|      |.|:.|..:.:....    |||.|..|...||||||..|:.:
Zfish   147 QVVTGNQTPHFLSTCRP------NYTALGCHSPMQYITERRACTGNPYLIASARKSFPSKDSALS 205

  Fly   228 FASFGFIAYYIGAKLHAFDSRGRGHTWR----------LCIAVIPLFIALLVAVSRTCDYHHHWQ 282
            ..|..:...|:..            .||          ||:.::.|  |:||.:.|..:|.:||.
Zfish   206 MYSAVYTVMYVTL------------VWRTKGTRLTKPTLCLTLLSL--AVLVGIVRVAEYRNHWS 256

  Fly   283 DVTIGGLI-GLFAGYI--------SYTQYY-----PSIFC-------PDAGIPLVRWPSREGSQY 326
            ||..|.|. |..|.::        ..||.:     |.:..       |...:|:|..|..|....
Zfish   257 DVLAGYLTGGAIAAFLVTCVINNFQQTQSHVPRLPPPVLPPPPPRPEPSLNMPMVAMPCVESPLE 321

  Fly   327 QRLSG 331
            .|..|
Zfish   322 NRFQG 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 40/157 (25%)
plppr2bXP_005165778.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577765
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.