DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and plppr3b

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_005156018.1 Gene:plppr3b / 570173 ZFINID:ZDB-GENE-120514-1 Length:694 Species:Danio rerio


Alignment Length:232 Identity:61/232 - (26%)
Similarity:90/232 - (38%) Gaps:57/232 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 LCMNGIPTSVLKITVGRPRPDYFYRCFPDGVMVLNTTSNGVDTSILDFN-------CTGLPGD-I 212
            ||...:.|.|:::..|...|.:...|.|      |.|..||.   .|.|       |.|.... |
Zfish   139 LCATALVTDVIQLATGYHTPFFLTVCKP------NYTIPGVS---CDKNPYITKDICAGQDQHAI 194

  Fly   213 NEGRKSFPSGHSSFAFASFGFIAYYIGAKLHAFDSRGRGHTWRLCIAVIPLF--IALLVAVSRTC 275
            ...||:|||.|::.:    .|.|.||..   .|:|.....|..|...::..|  .|.|..:::..
Zfish   195 LSARKTFPSQHATLS----SFAAVYISM---YFNSTISDSTKLLKPVLVFAFAIAAALTGLTQIT 252

  Fly   276 DYHHHWQDVTIGGLIGLFAGYISYTQYY-------PSIFCPDAGIPLVRWPSREGSQYQRLS--G 331
            .|..|..||.:|..||  ||..:|..::       |.    ||.||  :.|.::....:.|:  |
Zfish   253 QYRSHPIDVYVGFCIG--AGIAAYLAFHAVANFKSPE----DAVIP--QPPPQQKDALRALAQRG 309

  Fly   332 KDDNGSRG-----------PHHLDGGDAVRRPLLADK 357
            .|...::|           |..|||   :.||:..:|
Zfish   310 HDSVYNKGHASESNEEITSPASLDG---LNRPVQREK 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 44/155 (28%)
plppr3bXP_005156018.1 PAP2_wunen 127..276 CDD:239479 44/154 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577882
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.