DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and plpp1a

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_697507.5 Gene:plpp1a / 569053 ZFINID:ZDB-GENE-080225-26 Length:282 Species:Danio rerio


Alignment Length:139 Identity:52/139 - (37%)
Similarity:69/139 - (49%) Gaps:20/139 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 TSVLKITVGRPRPDYFYRCFPDGVMVLNTTSNGVDTSILDFNCTGLPGDINEGRKSFPSGHSSFA 227
            |.:.|.::||.||.:...|.||...: |.|:...   |.||.|||....:||||.||.||||||:
Zfish   116 TDIAKYSIGRLRPHFLDVCKPDWSKI-NCTAGAY---IEDFVCTGKESVVNEGRLSFYSGHSSFS 176

  Fly   228 FASFGFIAYYIGAKLHAFDSRGRGHTW-RLCIAVIPLFI---ALLVAVSRTCDYHHHWQDVTIGG 288
            .....|:|.|:.|::.|        .| ||....:..|:   ::...:||..||.|||.||    
Zfish   177 MYCMLFLALYLQARMQA--------EWARLLRPTLQFFLIAASVYTGLSRVSDYKHHWSDV---- 229

  Fly   289 LIGLFAGYI 297
            |.||..|.|
Zfish   230 LTGLIQGAI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 52/139 (37%)
plpp1aXP_697507.5 PAP2_wunen 98..244 CDD:239479 52/139 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577789
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.640

Return to query results.
Submit another query.