DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and ppap2d

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001073447.1 Gene:ppap2d / 559124 ZFINID:ZDB-GENE-061201-42 Length:323 Species:Danio rerio


Alignment Length:293 Identity:72/293 - (24%)
Similarity:123/293 - (41%) Gaps:93/293 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 SNAKLSDAVDVVLRVLLVITFF--KLETMTAFKR------------EIHEEELWLYKNPRRPD-- 113
            |:.|:...:|::..::..|.||  :|:.:|.:.|            .|..|.:        ||  
Zfish    49 SSRKMLVGLDILCLLVASIPFFACELKAVTPYMRGFFCGDTSITYPYIESEAI--------PDSV 105

  Fly   114 IVRGGELLFWVIVAPFLVTIAFYWYTRDRRDFRAASW--------------AWTLALCMNGIPTS 164
            ::.||     :|:....:.:...:..| .||..:.::              ::....|:....|:
Zfish   106 LIAGG-----IIITGLTIAVGECYRVR-FRDVHSRAFVRNLYVSCLYKELGSFLFGCCVGQSLTN 164

  Fly   165 VLKITVGRPRPDYFYRCFPDGVMVLNTTSNGVDTSILDFNCTGLPGD-------------INEGR 216
            :.|::|||.||.:...|        |.|...:       |||  ||.             :.|.|
Zfish   165 MAKLSVGRLRPHFLSAC--------NVTYESL-------NCT--PGTYISHVVCKSSKKIVEEAR 212

  Fly   217 KSFPSGHSSFAFASFGFIAYYIGAKLHAFDSRGRGHTWRLCIAVIPL--FIALLVAV----SRTC 275
            |||.|||:|||..:..::|:|:.|:|          :|:....:.||  |:.:::||    ||..
Zfish   213 KSFFSGHASFAMYTMLYLAFYLQARL----------SWQGARLLRPLLQFMLVMLAVYTGLSRIS 267

  Fly   276 DYHHHWQDVTIGGLI-GLFAGYISYTQYYPSIF 307
            ||.||..||..|.|. ||.|.::::  |..|:|
Zfish   268 DYRHHPTDVLTGFLQGGLTAYWVAF--YISSMF 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 58/233 (25%)
ppap2dNP_001073447.1 PAP2_wunen 145..291 CDD:239479 50/172 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577814
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.