DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and plpp3

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_001919561.1 Gene:plpp3 / 557680 ZFINID:ZDB-GENE-060526-241 Length:312 Species:Danio rerio


Alignment Length:326 Identity:79/326 - (24%)
Similarity:129/326 - (39%) Gaps:87/326 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AEDVRNTGSRTRTNDDEMWRNELAMNTDSSSVQPEKREERSHRTGNSNAKLSDAVDVVLRVLLVI 83
            |.:.||.|:.|..|:.                           ..||..||..|:|:...||.|:
Zfish    11 APETRNGGTSTLNNNG---------------------------VNNSKRKLLIALDIFCLVLAVL 48

  Fly    84 TFFKLETMT--AFKREIH---EEELWLYKNPRRPDIVRGGELLFWVIVAPFLVTIAF-------- 135
            .|..:||.|  .:.|..:   :...:.|||        |..:...|:.|..::.:.|        
Zfish    49 PFLIIETSTIKPYHRGFYCSDQSIQYPYKN--------GDTISDAVLCAAGILIVIFSIVIGECY 105

  Fly   136 --YWYTRDRRDFRAASWAWTL---------ALCMNGIPTSVLKITVGRPRPDYFYRCFPDGVMVL 189
              ::.::..:.|....:...|         ...::...|.:.|::|||.||.:...|.|:     
Zfish   106 RIHYLSQGSKSFVGNPYVSALYRQVGVFIFGCAVSQSFTDIAKVSVGRMRPHFLDVCRPN----- 165

  Fly   190 NTTSNGVDTS---ILDFNCTGLPGDINEGRKSFPSGHSSFAFASFGFIAYYIGAKLHAFDSRGRG 251
               .:.:|.|   |.::.|||.|..:.|.||||.|||:||:..:..::|:|:.::.         
Zfish   166 ---YSTIDCSLGYITEYTCTGDPSKVQEARKSFFSGHASFSMYTMLYLAFYLQSRF--------- 218

  Fly   252 HTWRLCIAVIPL--FIALLVA----VSRTCDYHHHWQDVTIGGLIGLFAGYISYTQYYPSIFCPD 310
             |||....:.||  |..|::|    :||..|:.||..||..|.:.|....| ....|...:|.|.
Zfish   219 -TWRGARLLRPLLQFTLLMMAFYTGLSRVSDHKHHPTDVLAGFVQGALVAY-CIVFYVSDLFKPK 281

  Fly   311 A 311
            |
Zfish   282 A 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 55/225 (24%)
plpp3XP_001919561.1 PAP2_wunen 125..271 CDD:239479 47/164 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577774
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.650

Return to query results.
Submit another query.