DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and sgpp1a

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_684347.1 Gene:sgpp1a / 556439 ZFINID:ZDB-GENE-030131-4695 Length:436 Species:Danio rerio


Alignment Length:359 Identity:71/359 - (19%)
Similarity:110/359 - (30%) Gaps:131/359 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QESRRTLSDSSAEDVRNTGSRTR----TNDDEMWRNELAMNTDSSSVQPEKREERSHRTGNSNAK 68
            ::..|..|..||:  |..|.|.|    ...||...|..|......:|:|.:|...:...|.    
Zfish    56 RQGAREASGDSAD--RLPGQRLRKSLNVKQDECAHNGPADTDPKGTVKPLRRNSLTGDVGQ---- 114

  Fly    69 LSDAVDVVLRVLLVITFFKLETMTAFKREIHEEELWLYKNPRRPDIVRGGELLFWVIVAPFLVTI 133
                 :.::....:...|.:.|           ||              |..:|:::..|||:..
Zfish   115 -----EFIIENKFLFYLFTIGT-----------EL--------------GNEMFFIVFFPFLMWN 149

  Fly   134 AFYWYTRDRRDFRAASWAWTLALCMNGIPT-SVLKITVGRP------RPDYFYRCFPDGVMVLNT 191
            ...:.:|.    ....|||.|.|   |..| .|::.|  ||      :.:.||            
Zfish   150 VDPYVSRQ----LIVVWAWVLFL---GQSTKDVVRWT--RPASPPVVKVEVFY------------ 193

  Fly   192 TSNGVDTSILDFNCTGLPGDINEGRKSFPSGHSSFAFASFGFIAYYIGAKLHAFDSRGRGHTWR- 255
                                  ....|.||.| :.:..:..|..:.:..      ||     |. 
Zfish   194 ----------------------NSEYSMPSTH-AMSGTALPFSLFLLTC------SR-----WEY 224

  Fly   256 -----LCIAVIPLFIALLVAVSRTCDYHHHWQDVTIGGLIGLF-------------AGYISYTQY 302
                 |.||   ||.::||.:||.....|...:|..|.|..:.             ..|:|:: |
Zfish   225 PFMFGLSIA---LFWSILVCISRIYMGMHSVLEVITGFLYSVLILAVLHPMLDDIDTFYLSHS-Y 285

  Fly   303 YP-SIFCPDAGIPLV-----RWPSREGSQYQRLS 330
            .| .:.....|..||     .|.:..|...|.|:
Zfish   286 APLVVLLVHVGFSLVAFSLDTWSTSRGDTAQALA 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 42/223 (19%)
sgpp1aXP_684347.1 PAP2_SPPase1 121..270 CDD:239482 44/231 (19%)
PgpB <122..281 CDD:223743 44/241 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.