DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and plppr3a

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001164499.1 Gene:plppr3a / 553336 ZFINID:ZDB-GENE-070912-555 Length:730 Species:Danio rerio


Alignment Length:226 Identity:60/226 - (26%)
Similarity:87/226 - (38%) Gaps:50/226 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 LCMNGIPTSVLKITVGRPRPDYFYRCFPDGVMVLNTTSNGV----DTSILDFNCTGLPG-DINEG 215
            ||...:.|.|:::..|...|.:...|.|      |.|..||    :..|....|:|... .|...
Zfish   156 LCATALVTDVIQLATGYHAPFFLTVCKP------NYTLPGVACDKNPYITQDICSGRDQYAILSA 214

  Fly   216 RKSFPSGHSSFAFASFGFIAYYIGAKLHAFDSRGRGHTWRLCIAVIPLFIAL---LVAVSRTCDY 277
            ||:|||.|::.:    ||.|.||....:|..|    .:.:|...|:....|:   |.::::...|
Zfish   215 RKTFPSQHATLS----GFAAVYISMYFNATIS----DSTKLLKPVLVFAFAIAAALASLTQITQY 271

  Fly   278 HHHWQDVTIGGLIGLFAGYISYTQYY--------------PSIFCPDAGIPLVRWPSREGSQ--- 325
            ..|..||.:|.:||  ||...|...|              |....|    |..:.|.||.:|   
Zfish   272 RSHPIDVYVGFVIG--AGIAVYLALYAVGNFRSNEEASPRPLKQPP----PPQKDPLRELTQRGH 330

  Fly   326 ---YQRLSGKDDNGS-RGPHHLDG-GDAVRR 351
               ||:....:.|.. ..|.|:.| ...|||
Zfish   331 DSVYQKAHASESNDELTAPPHVAGLNRKVRR 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 43/153 (28%)
plppr3aNP_001164499.1 PAP2_wunen 144..293 CDD:239479 43/152 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577883
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.