DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and plpp3

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001016858.3 Gene:plpp3 / 549612 XenbaseID:XB-GENE-941073 Length:307 Species:Xenopus tropicalis


Alignment Length:271 Identity:69/271 - (25%)
Similarity:114/271 - (42%) Gaps:76/271 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 DSSSVQPEKR-----EERSHRTGNSNAKLSD----AVDVVLRVLLVIT--FFKLETMTAFKREIH 99
            ::|::||.:|     :|......||...:||    ||.:::.:|.:|.  ||:          ||
 Frog    55 ETSTIQPYRRGFYCDDESIKYPANSGETISDAVLSAVGILIAILAIIVGEFFR----------IH 109

  Fly   100 EEELWLYKNPRRPDIVRGGELLFWVIVAPFLVTIAFYWYTRDRRDFRAASWAWTLALCMNGIPTS 164
                :|.:.|..            .|..|::.  |.|        .:...:|:..|:..:.  |.
 Frog   110 ----YLKERPHS------------FIQNPYVA--ALY--------KQVGCFAFGCAVSQSF--TD 146

  Fly   165 VLKITVGRPRPDYFYRCFPDGVMVLNTTSNGVDTS---ILDFNCTGLPGDINEGRKSFPSGHSSF 226
            :.|:.:||.||.:...|.||        .:.:|.|   |.::.|.|.|..:.|.||||.|||:||
 Frog   147 IAKVAIGRLRPHFINVCNPD--------FSTIDCSLGYIENYQCRGPPNKVMEARKSFFSGHASF 203

  Fly   227 AFASFGFIAYYIGAKLHAFDSRGRGHTWRLCIAVIPL--FIALLVA----VSRTCDYHHHWQDVT 285
            :..:..::..|:.::.          |||....:.||  |..|::|    :||..|:.||..||.
 Frog   204 SMYTMLYLVLYLQSRF----------TWRGARLLRPLLQFTLLMMAFYTGLSRVSDHKHHPSDVL 258

  Fly   286 IGGLIGLFAGY 296
            .|.:.|....|
 Frog   259 AGFVQGALVAY 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 52/202 (26%)
plpp3NP_001016858.3 PAP2_wunen 126..272 CDD:239479 48/172 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3374
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.