DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and CG11425

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster


Alignment Length:259 Identity:72/259 - (27%)
Similarity:103/259 - (39%) Gaps:66/259 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VDVVLRVLLVI---TFFKLETMTAFKREIHEEELWLYKNPRRPDIVRGGELLFWV-IVAPFLVTI 133
            ||:||..||::   .|.:|......:....::|..:|  |...:.| ...||.|: :..|.:..:
  Fly    15 VDLVLLGLLIVLVENFRRLWGPPTKRGFFCDDESLMY--PYHENTV-SPTLLHWLGLYLPLISLV 76

  Fly   134 AFYWYTRDRRDFRAASW----------AWTL-ALCMNGIPTSVLKITVGRPRPDYFYRC---FPD 184
            ....:...|:|.  |.|          .|.| ....|.:...:.|..:||.||.:|..|   |||
  Fly    77 VLESFLSHRKDM--APWPTLWPVYNTVRWFLYGYVSNDLLKGIGKQALGRLRPHFFAVCSPHFPD 139

  Fly   185 GVMVLNTTSNGVDTSILDFNCTGLPG----------DINEGRKSFPSGHSSFAFASFGFIAYYIG 239
            |...|:.:..|......|:.|.  |.          |:|   .|||||||:.||....|:|.:: 
  Fly   140 GSSCLDESHRGALKYHTDYECR--PNLSQATEEMIRDVN---VSFPSGHSAMAFYGLVFVALHL- 198

  Fly   240 AKLHAFDSRGRGHTWRL------------CIAVIPLFIALLVAVSRTCDYHHHWQDVTIGGLIG 291
                      |...|.|            |:|     :|..||:||..||.|||.||..|.|:|
  Fly   199 ----------RRRRWPLRGSLLSPVLQLACVA-----LAWFVAISRVIDYKHHWSDVAAGSLLG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 63/225 (28%)
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 52/173 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445056
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001532
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X622
54.930

Return to query results.
Submit another query.