DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and CG11438

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001287145.1 Gene:CG11438 / 40469 FlyBaseID:FBgn0037164 Length:341 Species:Drosophila melanogaster


Alignment Length:237 Identity:58/237 - (24%)
Similarity:95/237 - (40%) Gaps:60/237 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 IAFYWYTRDRRDFRAASWAWTLALCMNGIPTSVLKITVGRPRPDYFYRC---FPDGVMVLNTTSN 194
            :.||.|                .|.|....|.:.|:.:||.||.:...|   .|||....:..:.
  Fly   108 VIFYLY----------------GLAMVTFTTMLTKLCLGRLRPHFLAVCQPMLPDGSSCQDAQNL 156

  Fly   195 G--VDTSILDFNCTG---LPGDINEGRKSFPSGHSSFAFASFGFIAYYIGAKLHAFDSRGRGHTW 254
            |  :|:    |.|:.   ......|..:||||||:|.|..:..::|.|:.|.|....|:...|..
  Fly   157 GRYIDS----FTCSNANMTDYQFKELYQSFPSGHASMAMYAMLYLAIYLQAALSTRVSKLLKHLL 217

  Fly   255 RLCIAVIPLFIALLVAVSRTCDYHHHWQDVTIGGLIGLFAGYISYTQYYPSIFCPDAGIPLVRWP 319
            :....:...:::|    :|..||:|||.||..|..:|:...::: :.|...:|   ||   .|||
  Fly   218 QFLFVMFGWYVSL----TRIIDYYHHWSDVLAGAALGVVFAWLT-SAYVADLF---AG---KRWP 271

  Fly   320 SREGSQYQRLSGKDDNGSRGPHHLDGGDAVRRPLLADKEESK 361
            .         :|...|            .:|:|.::.|..:|
  Fly   272 K---------TGYSAN------------TLRKPQVSPKSSTK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 45/176 (26%)
CG11438NP_001287145.1 PAP2_wunen 104..257 CDD:239479 45/172 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445057
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 1 1.100 - - P PTHR10165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.