DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and plppr2a

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_956750.1 Gene:plppr2a / 393428 ZFINID:ZDB-GENE-040426-1171 Length:360 Species:Danio rerio


Alignment Length:296 Identity:67/296 - (22%)
Similarity:107/296 - (36%) Gaps:77/296 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 VLRVLLVITFFKLETMTAFKREIHEEELWL------YKNPRRPDIVRGGELLFWVIVAPFLVTIA 134
            ::..:..||....|.|..|.|....:|..:      |.||....|:|            ||....
Zfish    91 LIAAIPTITILAGEVMVFFMRAEGTQEKTIVTADCCYFNPLLRRIIR------------FLGVYT 143

  Fly   135 FYWYTRDRRDFRAASWAWTLALCMNGIPTSVL-----KITVGRPRPDYFYRCFPDGVMVLNTTSN 194
            |                        |:.|:.:     ::..|...|.:...|.|      |.|:.
Zfish   144 F------------------------GVFTTTIFANAGQVVTGNQTPHFLSACRP------NYTAL 178

  Fly   195 GVDTSILDFN----CTGLPGDINEGRKSFPSGHSSFAFASFGFIAYYIGAKLHAFDSRGRGHTWR 255
            |..:::....    |||.|..:...||||||..::.:..|..:...|:..   .|.::|...| :
Zfish   179 GCHSNLQYITERKACTGNPLIVASARKSFPSKDAALSVYSAVYTVMYVTL---VFRTKGTRLT-K 239

  Fly   256 LCIAVIPLFIALLVAVSRTCDYHHHWQDVT----IGGLIGLFAGYISYTQYYPSIFCPDA----- 311
            ..:::..|.:|:||.|.|..:|.:||.||.    .||.|.:|........:..:...|.|     
Zfish   240 PTLSLTLLCLAMLVGVVRVAEYRNHWSDVLAGFFTGGAIAVFLVTCVINNFQQTKPPPPAVRVQR 304

  Fly   312 -----GIPLVRWPSREGSQYQRLSGKDDNGSRGPHH 342
                 |:|:|..|..| |..::|.| |.:..|...|
Zfish   305 PESVLGMPMVALPCVE-SPLEKLQG-DLHSLRSHDH 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 47/216 (22%)
plppr2aNP_956750.1 PAP2_wunen 134..283 CDD:239479 44/194 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577766
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.