DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and wun

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster


Alignment Length:366 Identity:92/366 - (25%)
Similarity:150/366 - (40%) Gaps:99/366 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TASKEGQESRRTLSDSSAEDVR-----NTGSR-TRTNDDEMWRNELAMNTDSSSVQ--------- 51
            |::.|....||  |::...|.:     |:.|| |..|.:.        |..|:|||         
  Fly    12 TSASETTPLRR--SENETPDHKELAQSNSNSRQTTVNSNN--------NNYSNSVQVRLQEQDRD 66

  Fly    52 --PEKREERSHRTGNSNAKLSDAVDVVLRVLL-----VITFFKLETMTAFKREI--HEEELWLYK 107
              .|:::..:..|.::|.::...|.:.:.:||     ::.||.|.  ..:||..  .:|.|   |
  Fly    67 SDSEQQQHTATITMDTNKRILCRVGLDVLILLCAGFPILLFFLLG--EPYKRGFFCDDESL---K 126

  Fly   108 NPRRPDIVRGGELLFWVIVAP----FLVTIAFYWYTRDRRD-------------FRAASW----- 150
            :|.....||...|.|...|.|    |:|.:... ..:.::|             :....|     
  Fly   127 HPFHDSTVRNWMLYFIGAVIPVGVIFIVEVIIS-QNKAKQDNGNATSRRYVFMNYELPDWMIECY 190

  Fly   151 ----AWTLALCMNGIPTSVLKITVGRPRPDYFYRCFP---DGVMVLNTTSNGVDTS--ILDFNCT 206
                .:.....::.:.|.:.|.::||.||.:...|.|   ||    :|..:.::..  |.:|.|.
  Fly   191 KKIGIYAFGAVLSQLTTDIAKYSIGRLRPHFIAVCQPQMADG----STCDDAINAGKYIQEFTCK 251

  Fly   207 GLPGD---INEGRKSFPSGHSSFAFASFGFIAYYIGAKLHAFDSRGRGHTW------RLCIAVIP 262
            |:...   :.|.|.|||||||||.|.:..::|.|:.|::          ||      |..:..:.
  Fly   252 GVGSSARMLKEMRLSFPSGHSSFTFFAMVYLALYLQARM----------TWRGSKLLRHLLQFLF 306

  Fly   263 LFIALLVAVSRTCDYHHHWQDVTIGGLIG-----LFAGYIS 298
            :.:|...|:||..||.|||.||..|.|||     :.|.|:|
  Fly   307 IMVAWYTALSRVSDYKHHWSDVLAGSLIGSISALVVANYVS 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 63/240 (26%)
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 48/168 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445054
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 1 1.100 - - P PTHR10165
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3374
SonicParanoid 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.