DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and plpp2b

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_956247.1 Gene:plpp2b / 335485 ZFINID:ZDB-GENE-030131-7425 Length:273 Species:Danio rerio


Alignment Length:159 Identity:59/159 - (37%)
Similarity:78/159 - (49%) Gaps:34/159 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 TSVLKITVGRPRPDYFYRCFP---DGVMVLNTTSNGVDTSILDFNCTGLPGDINEGRKSFPSGHS 224
            |.:.|.|:|||||::...|.|   .|.:.||             ||||.|.|:.|.|.||.||||
Zfish   113 TDLAKYTIGRPRPNFLAVCAPKVCKGFVNLN-------------NCTGNPADVTEARLSFYSGHS 164

  Fly   225 SFAFASFGFIAYYIGAKLHAFDSRGRGHTW-RLCIAVIPLFI---ALLVAVSRTCDYHHHWQDVT 285
            |||.....|:|:|:.|:|:|        .| ||....|..|:   |:.|..:|..||.|||.||.
Zfish   165 SFAMYCMLFLAFYVQARLNA--------KWARLLRPTIQFFLVAFAVYVGYTRVSDYKHHWSDVM 221

  Fly   286 IGGLIG-----LFAGYIS-YTQYYPSIFC 308
            :|.|.|     |...::| :.:..||..|
Zfish   222 VGLLQGALIAILTVRFVSNFFKVSPSPEC 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 56/151 (37%)
plpp2bNP_956247.1 PAP2_wunen 94..235 CDD:239479 55/142 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577885
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.650

Return to query results.
Submit another query.