DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and Plppr5

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_038958360.1 Gene:Plppr5 / 310812 RGDID:1309567 Length:344 Species:Rattus norvegicus


Alignment Length:269 Identity:61/269 - (22%)
Similarity:99/269 - (36%) Gaps:65/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DEMWRNELAMNTDSSSVQPEKREERSHRTGNSNAKLSDAVDVVLRVLLVITFFKLETMTAFKREI 98
            |..:|.......|||:|.|...           ..|:..|.|::.::.....|.|:..|   |:.
  Rat    47 DSAYRKPYPGPEDSSAVPPVLL-----------YSLAAGVPVLVIIVGETAVFCLQLAT---RDF 97

  Fly    99 HEEELWL------YKNPRRPDIVRGGELLFWVIVAPFLVTIAFYWYTRDRRDFRAASWAWTLALC 157
            ..:|..:      |.||.....||            ||...||..:..|                
  Rat    98 ENQEKTILTGDCCYINPLVRRTVR------------FLGIYAFGLFATD---------------- 134

  Fly   158 MNGIPTSVLKITVGRPRPDYFYRCFPDGVMVLNTTSNGVD--TSIL--DFNCTGLPGDINEGRKS 218
               |..:..::..|...|.:...|.|      |.|:.|..  |..:  :..|||.|..|...||:
  Rat   135 ---IFVNAGQVVTGNLAPHFLALCKP------NYTALGCQQYTQFISGEEACTGNPDLIMRARKT 190

  Fly   219 FPSGHSSFAFASFGFIAYYIGAKLHAFDSRGRGHTWRLCIAVIPLFIALLVAVSRTCDYHHHWQD 283
            |||..::.:..:..::..||...:.|..:|.....  ||:.:  :.:|.|..::|..:|.:||.|
  Rat   191 FPSKEAALSVYAAMYLTMYITNTIKAKGTRLAKPV--LCLGL--MCLAFLTGLNRVAEYRNHWSD 251

  Fly   284 VTIGGLIGL 292
            |..|.|:|:
  Rat   252 VIAGFLVGI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 46/199 (23%)
Plppr5XP_038958360.1 PAP2_wunen 118..267 CDD:239479 43/184 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338388
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.