DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and Plppr2

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_006242690.1 Gene:Plppr2 / 300443 RGDID:1597171 Length:452 Species:Rattus norvegicus


Alignment Length:324 Identity:69/324 - (21%)
Similarity:118/324 - (36%) Gaps:70/324 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VDVVLRVLLVITFFKLETMTAFKREIHEEELWLYKN------PRRPDIVRGGELLFWVIV--APF 129
            |:.||..::::..::||....|  .:|.:..:.|.:      |......|....|.:.:|  .|.
  Rat    21 VESVLLGIVILLAYRLEFTDTF--PVHTQGFFCYDSAYAKPYPGPEAASRAPPALIYALVTAGPT 83

  Fly   130 LVTI------AFYWYTRDRRDFRAASWAWTLALCMNGIP-----------------TSVL----K 167
            |..:      ||:............|...:.|.|....|                 |::.    :
  Rat    84 LTILLGELARAFFPAPPSASPVSGESTIVSGACCRFSPPLRRLVRFLGVYSFGLFTTTIFANAGQ 148

  Fly   168 ITVGRPRPDYFYRCFPD----GVMVLNTTSNGVDTSILDFN-CTGLPGDINEGRKSFPSGHSSFA 227
            :..|.|.|.:...|.|:    |....:....|.|..:.|.: |.|.|..:...|::||...::..
  Rat   149 VVTGNPTPHFLSVCRPNYTALGCPPPSPDRPGPDRFVTDQSACAGSPSLVAAARRAFPCKDAALC 213

  Fly   228 FASFGFIAYYIGAKLHAFDSRGRGHTWRLCIAVI-PLFIALLVAVSRTCDYHHHWQDVTIGGLIG 291
            ..:..:.|.|:........||....:  ||:|:: |.|   ||.|.|..:|.:||.||..|.|.|
  Rat   214 AYAVTYTAMYVTLVFRVKGSRLVKPS--LCLALLCPAF---LVGVVRVAEYRNHWSDVLAGFLTG 273

  Fly   292 LFAGYISYTQYYPSIFC--------PDAGIPLVRW------PSREGSQYQRLSGKDDNGSRGPH 341
              |...::.     :.|        |.:|..|..|      |:.: |..::||...:..:..||
  Rat   274 --AAIATFL-----VTCVVHNFQSRPLSGRRLSPWEDLSQAPTMD-SPLEKLSVAQEPETCRPH 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 51/238 (21%)
Plppr2XP_006242690.1 PAP2_wunen 125..281 CDD:239479 38/167 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338320
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.