DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and Plppr1

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_958428.2 Gene:Plppr1 / 298062 RGDID:1303116 Length:325 Species:Rattus norvegicus


Alignment Length:260 Identity:65/260 - (25%)
Similarity:97/260 - (37%) Gaps:62/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 IHEEELWL-----YKNPRRPDIVRGGELLFWVIVAPFLVTIAFYWYTRDRRDFRAASWAWTLALC 157
            |.||::.|     |.:|....|||            |:...||..:..|                
  Rat   103 IAEEKMILTGDCCYLSPLLRRIVR------------FIGVFAFGLFATD---------------- 139

  Fly   158 MNGIPTSVLKITVGRPRPDYFYRCFPDGVMVLNTTSNGVDTSILDFN----CTGLPGDINEGRKS 218
               |..:..::..|...|.:...|.|      |.||..........|    |||....|.:.|:|
  Rat   140 ---IFVNAGQVVTGHLTPYFLTVCQP------NYTSTDCRAHHQFINNGNICTGDLEVIEKARRS 195

  Fly   219 FPSGHSSFAFASFGFIAYYIGAKLHAFDSRGRGHTWRLCIAVIPLFIALLVAVSRTCDYHHHWQD 283
            |||.|::.:..|..:...||.:.:....||.....  ||:..  |..|.|..::|..:|.:|..|
  Rat   196 FPSKHAALSIYSALYATMYITSTIKTKSSRLAKPV--LCLGT--LCTAFLTGLNRVSEYRNHCSD 256

  Fly   284 VTIGGLIG----LFAGY-----ISYTQYYPSIFCPD--AGIPLVRWPSREGSQYQRLSGKDDNGS 337
            |..|.::|    ||.|.     ...||...|...|:  .|:||:.:|..| |..:.||.::.:.|
  Rat   257 VIAGFILGTAVALFLGMCVVHNFKGTQGSASKPKPEDPRGVPLMAFPRIE-SPLETLSAQNHSAS 320

  Fly   338  337
              Rat   321  320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 50/215 (23%)
Plppr1NP_958428.2 PAP2_wunen 123..272 CDD:239479 45/189 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338387
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.