DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and Plppr1

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_848871.1 Gene:Plppr1 / 272031 MGIID:2445015 Length:325 Species:Mus musculus


Alignment Length:260 Identity:65/260 - (25%)
Similarity:98/260 - (37%) Gaps:62/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 IHEEELWL-----YKNPRRPDIVRGGELLFWVIVAPFLVTIAFYWYTRDRRDFRAASWAWTLALC 157
            |.||::.|     |.:|....|:|            |:...||..:..|                
Mouse   103 IAEEKMILTGDCCYLSPLLRRIIR------------FIGVFAFGLFATD---------------- 139

  Fly   158 MNGIPTSVLKITVGRPRPDYFYRCFPDGVMVLNTTSNGVDTSILDFN----CTGLPGDINEGRKS 218
               |..:..::..|...|.:...|.|      |.||..........|    |||....|.:.|:|
Mouse   140 ---IFVNAGQVVTGHLTPYFLTVCQP------NYTSTDCRAHQQFINNGNICTGDLEVIEKARRS 195

  Fly   219 FPSGHSSFAFASFGFIAYYIGAKLHAFDSRGRGHTWRLCIAVIPLFIALLVAVSRTCDYHHHWQD 283
            |||.|::.:..|..:...||.:.:....||.....  ||:..  |..|.|..::|..:|.:|..|
Mouse   196 FPSKHAALSIYSALYATMYITSTIKTKSSRLAKPV--LCLGT--LCTAFLTGLNRVSEYRNHCSD 256

  Fly   284 VTIGGLIG----LFAGY-----ISYTQYYPSIFCPD--AGIPLVRWPSREGSQYQRLSGKDDNGS 337
            |..|.::|    ||.|.     ...||..||...|:  .|:||:.:|..| |..:.||.::.:.|
Mouse   257 VIAGFILGTAVALFLGMCVVHNFRGTQGSPSKPKPEDPRGVPLMAFPRIE-SPLETLSAQNHSAS 320

  Fly   338  337
            Mouse   321  320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 49/215 (23%)
Plppr1NP_848871.1 PAP2_wunen 123..272 CDD:239479 44/189 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834805
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.