DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and SPBC409.18

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_595468.1 Gene:SPBC409.18 / 2541078 PomBaseID:SPBC409.18 Length:279 Species:Schizosaccharomyces pombe


Alignment Length:265 Identity:77/265 - (29%)
Similarity:124/265 - (46%) Gaps:58/265 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LLVITF---FKLETMT-AFKREIHEE--------------ELWLYKNPRRPDIVRGGELLFWVIV 126
            :|::.|   |.||.:| :....:||:              .|.||...:    :|...||||..:
pombe    33 VLMLPFTRQFSLEDITISHPFALHEQVPTKYLGIICVFFPALVLYGFGK----LRNNSLLFWKSL 93

  Fly   127 APFLVTIAFYWYTRDRRDFRAASWAWTLALCMNGIPTSVLKITVGRPRPDYFYRCFPDGVMVLNT 191
            ...|                     ::..:|  |:..|:||..|||||||:..||.|     ..:
pombe    94 MGLL---------------------YSTMVC--GLCVSLLKNAVGRPRPDFLARCQP-----FES 130

  Fly   192 TSNGVDTSILDFNCTGLPGD---INEGRKSFPSGHSSFAFASFGFIAYYIGAKLHAFDSRGRGHT 253
            |..   |.::|.....:|..   :.:|.:||||||:||:||..||:|.::..:|..|  |.:..:
pombe   131 TPK---TGLVDVLSCSVPWSDKVLQDGFRSFPSGHTSFSFAGLGFLAIFLAGQLKMF--RNKTSS 190

  Fly   254 WRLCIAVIPLFIALLVAVSRTCDYHHHWQDVTIGGLIGLFAGYISYTQYYPSIFCPDAGIPLVRW 318
            |::.:.::||.||..:.:||:.||.||.:|:.:|.|.|....|:.|.|.:|.:...:|.|..|:.
pombe   191 WKVVVPLVPLSIASWIGLSRSQDYRHHKEDIAVGALFGFAIAYVVYRQLFPPLDHHNADILYVQA 255

  Fly   319 PSREG 323
            ...||
pombe   256 ELDEG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 61/200 (31%)
SPBC409.18NP_595468.1 PgpB 7..247 CDD:223743 72/250 (29%)
PAP2_containing_1_like 47..238 CDD:239484 65/227 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 103 1.000 Domainoid score I1744
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001532
OrthoInspector 1 1.000 - - oto101897
orthoMCL 1 0.900 - - OOG6_100228
Panther 1 1.100 - - O PTHR10165
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3374
SonicParanoid 1 1.000 - - X622
TreeFam 1 0.960 - -
1110.800

Return to query results.
Submit another query.