DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and Plppr2

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001277228.1 Gene:Plppr2 / 235044 MGIID:2384575 Length:452 Species:Mus musculus


Alignment Length:324 Identity:70/324 - (21%)
Similarity:118/324 - (36%) Gaps:70/324 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VDVVLRVLLVITFFKLETMTAFKREIHEEELWLYKN------PRRPDIVRGGELLFWVIV--APF 129
            |:.||..::|:..::||....|  .:|.:..:.|.:      |......|....|.:.:|  .|.
Mouse    21 VESVLLGIVVLLAYRLEFTDTF--PVHTQGFFCYDSAYAKPYPGPEAASRAPPALIYALVTAGPT 83

  Fly   130 LVTI------AFYWYTRDRRDFRAASWAWTLALCMNGIP-----------------TSVL----K 167
            |..:      ||:............|...:.|.|....|                 |::.    :
Mouse    84 LTILLGELARAFFPAPPSSSPVSGESTIVSGACCRFSPPLRRLVRFLGVYSFGLFTTTIFANAGQ 148

  Fly   168 ITVGRPRPDYFYRCFPD----GVMVLNTTSNGVDTSILDFN-CTGLPGDINEGRKSFPSGHSSFA 227
            :..|.|.|.:...|.|:    |....:....|.|..:.|.: |.|.|..:...|::||...::..
Mouse   149 VVTGNPTPHFLSVCRPNYTALGCPPPSPDRPGPDRFVTDQSACAGSPSLVAAARRAFPCKDAALC 213

  Fly   228 FASFGFIAYYIGAKLHAFDSRGRGHTWRLCIAVI-PLFIALLVAVSRTCDYHHHWQDVTIGGLIG 291
            ..:..:.|.|:........||....:  ||:|:: |.|   ||.|.|..:|.:||.||..|.|.|
Mouse   214 AYAVTYTAMYVTLVFRVKGSRLVKPS--LCLALLCPAF---LVGVVRVAEYRNHWSDVLAGFLTG 273

  Fly   292 LFAGYISYTQYYPSIFC--------PDAGIPLVRW------PSREGSQYQRLSGKDDNGSRGPH 341
              |...::.     :.|        |.:|..|..|      |:.: |..::||...:..:..||
Mouse   274 --AAIATFL-----VTCVVHNFQSRPHSGRRLSPWEDLSQAPTMD-SPLEKLSVAQEPETCRPH 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 51/238 (21%)
Plppr2NP_001277228.1 PAP2_wunen 125..281 CDD:239479 38/167 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834738
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.