DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and PLPP4

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001025230.1 Gene:PLPP4 / 196051 HGNCID:23531 Length:271 Species:Homo sapiens


Alignment Length:243 Identity:109/243 - (44%)
Similarity:152/243 - (62%) Gaps:26/243 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 AVDVVLRVLLVITFFKLETMTAFKREIHEEELWLYKNPRRPDIVRGGEL---LFWVIVAPFLVTI 133
            |:::.:|.||...|...|.:..|:|.|..||:||||||    :|:...:   |.:.|  .||..:
Human     5 AIEIGVRALLFGVFVFTEFLDPFQRVIQPEEIWLYKNP----LVQSDNIPTRLMFAI--SFLTPL 63

  Fly   134 AFYWYTR-----DRRDFRAASWAWTLALCMNGIPTSVLKITVGRPRPDYFYRCFPDGVMVLNTTS 193
            |.....:     |:.:.:.|..|.:|||.:||:.|:.:|:.|||||||:||||||||||  |:  
Human    64 AVICVVKIIRRTDKTEIKEAFLAVSLALALNGVCTNTIKLIVGRPRPDFFYRCFPDGVM--NS-- 124

  Fly   194 NGVDTSILDFNCTGLPGDINEGRKSFPSGHSSFAFASFGFIAYYIGAKLHAFDSRGRGHTWRLCI 258
                    :.:|||.|..::||||||||.||||||:..||..:|:..|||.|...|||.:||||.
Human   125 --------EMHCTGDPDLVSEGRKSFPSIHSSFAFSGLGFTTFYLAGKLHCFTESGRGKSWRLCA 181

  Fly   259 AVIPLFIALLVAVSRTCDYHHHWQDVTIGGLIGLFAGYISYTQYYPSI 306
            |::||:.|:::|:||.|||.|||||..:||:|||...||.|.|:||.:
Human   182 AILPLYCAMMIALSRMCDYKHHWQDSFVGGVIGLIFAYICYRQHYPPL 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 95/205 (46%)
PLPP4NP_001025230.1 PAP2_containing_1_like 37..225 CDD:239484 95/205 (46%)
Phosphatase sequence motif I. /evidence=ECO:0000269|PubMed:17590538 102..110 5/7 (71%)
Phosphatase sequence motif II. /evidence=ECO:0000269|PubMed:17590538 143..146 2/2 (100%)
Phosphatase sequence motif III. /evidence=ECO:0000269|PubMed:17590538 195..205 7/9 (78%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144695
Domainoid 1 1.000 183 1.000 Domainoid score I3430
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3620
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50067
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 1 1.000 - - FOG0001532
OrthoInspector 1 1.000 - - otm42010
orthoMCL 1 0.900 - - OOG6_100228
Panther 1 1.100 - - O PTHR10165
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3374
SonicParanoid 1 1.000 - - X622
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.