DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and Plpp3

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_620260.2 Gene:Plpp3 / 192270 RGDID:620454 Length:312 Species:Rattus norvegicus


Alignment Length:270 Identity:67/270 - (24%)
Similarity:115/270 - (42%) Gaps:49/270 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SVQPEKRE------ERSHRTGNSNAKLSDAVDVVLRVLLVITFFKLETMT--AFKREIH--EEEL 103
            ::.||.:.      ..:.|.|.|...|...:|:....:..:.|..:||.|  .::|..:  :|.:
  Rat     9 AIVPESKNGGSPALNNNPRKGGSKRVLLICLDLFCLFMAALPFLIIETSTIKPYRRGFYCNDESI 73

  Fly   104 WLYKNPRR-PDIVRGGELLFWVIVAPFL--VTIAFY--WYTRDR------RDFRAASW----AWT 153
               |.|.: .:.:....|....||...|  :|..||  :|.:::      ..:.||.:    .:.
  Rat    74 ---KYPLKVSETINDAVLCAVGIVIAILAIITGEFYRIYYLKEKSRSTIQNPYVAALYKQVGCFL 135

  Fly   154 LALCMNGIPTSVLKITVGRPRPDYFYRCFPDGVMVLNTTSNGVDTSILDFNCTGLPGDINEGRKS 218
            ....::...|.:.|:::||.||.:...|.||...:     |..:..|.::.|.|....:.|.|||
  Rat   136 FGCAISQSFTDIAKVSIGRLRPHFLSVCDPDFSQI-----NCSEGYIQNYRCRGEDSKVQEARKS 195

  Fly   219 FPSGHSSFAFASFGFIAYYIGAKLHAFDSRGRGHTWRLCIAVIPL--FIALLVA----VSRTCDY 277
            |.|||:||:..:..::..|:.|:.          |||....:.||  |..|::|    :||..||
  Rat   196 FFSGHASFSMFTMLYLVLYLQARF----------TWRGARLLRPLLQFTLLMMAFYTGLSRVSDY 250

  Fly   278 HHHWQDVTIG 287
            .||..||..|
  Rat   251 KHHPSDVLAG 260

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 54/205 (26%)