DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and Plpp1

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_032273.1 Gene:Plpp1 / 19012 MGIID:108412 Length:284 Species:Mus musculus


Alignment Length:267 Identity:74/267 - (27%)
Similarity:112/267 - (41%) Gaps:69/267 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 AVDV--VLRVLLVITFFKLETMTAFKR-----------EIHEEELWLYKNPRRPDIVRG------ 117
            |:||  ||...:.:|..||..:..|:|           ..|:..:     |.|...:.|      
Mouse    11 ALDVICVLLAAMPMTILKLGKVYPFQRGFFCTDNSVKYPYHDSTI-----PSRILAILGLGLPIF 70

  Fly   118 ----GELL---FWVIVA------PFLVTIAFYWYTRDRRDFRAASWAWTLALCMNGIPTSVLKIT 169
                ||.|   |.|:.:      |::.||           ::|.. |:...:..:...|.:.|.|
Mouse    71 SMSIGESLSVYFNVLHSNSFVGNPYIATI-----------YKAVG-AFLFGVSASQSLTDIAKYT 123

  Fly   170 VGRPRPDYFYRCFPDGVMVLNTTSNGVDTSILDFNCTGLPGDINEGRKSFPSGHSSFAFASFGFI 234
            :|..||.:...|.||...:     |..|..|.|:.|.|....:.|||.||.||||||:.....|:
Mouse   124 IGSLRPHFLAICNPDWSKI-----NCSDGYIEDYICQGNEEKVKEGRLSFYSGHSSFSMYCMLFV 183

  Fly   235 AYYIGAKLHAFDSRGRGHTWRLCIAVIP---LFIALLVAVSRTCDYHHHWQDVTIGGLIG----- 291
            |.|:.|::       :|...||...::.   :..::.|.:||..||.|||.|||:|.:.|     
Mouse   184 ALYLQARM-------KGDWARLLRPMLQFGLIAFSIYVGLSRVSDYKHHWSDVTVGLIQGAAMAI 241

  Fly   292 LFAGYIS 298
            |.|.|:|
Mouse   242 LVALYVS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 63/222 (28%)
Plpp1NP_032273.1 PAP2_wunen 99..244 CDD:239479 50/168 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834754
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3374
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.670

Return to query results.
Submit another query.