DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and plpr-1

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_496399.1 Gene:plpr-1 / 174710 WormBaseID:WBGene00011524 Length:396 Species:Caenorhabditis elegans


Alignment Length:219 Identity:53/219 - (24%)
Similarity:87/219 - (39%) Gaps:61/219 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 PDIVRGGELLFWVI-VAPFLVTIA------FYWYTRDRRDFRAASWAWTLALCMNGIPTSVLKIT 169
            |.::..||::||:. ..|..:..|      .:.:|  ||.||... .:...|.:..|....:|:.
 Worm   106 PLVILIGEVMFWLFSTKPRKIVYANCGECPVHLFT--RRLFRFVI-IYLAGLLIVQIFVDTIKLM 167

  Fly   170 VGRPRPDYFYRCFPDGVMVLNTTSNGVDTSILDFNCTGLP---------GDINEGRKSFPSGH-- 223
            .|..||.:...|         ..|....|:.|:.:.:..|         .::.....:|||.|  
 Worm   168 TGYQRPYFLSLC---------NVSITACTAPLEHSPSPSPHLACNYRGADELRYAWLTFPSLHAV 223

  Fly   224 -SSFA--FASFGFIAYYI---GAKLHAFDSRGRGHTWRLCIAVIPLFI------ALLVAVSRTCD 276
             ||:|  |||. :|.|.|   ||.|                 :.||.|      .::.:.||...
 Worm   224 VSSYAACFASL-YIYYMINLRGAPL-----------------LRPLLIFGFMGLCIVDSFSRING 270

  Fly   277 YHHHWQDVTIGGLIGLF-AGYISY 299
            |.:||:|:.:..:||:| |.::.|
 Worm   271 YKNHWRDIWVAWVIGIFMAWFLCY 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 53/219 (24%)
plpr-1NP_496399.1 PAP2_wunen 142..293 CDD:239479 43/178 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.