DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and plpp-1.2

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001122646.1 Gene:plpp-1.2 / 174071 WormBaseID:WBGene00020895 Length:358 Species:Caenorhabditis elegans


Alignment Length:277 Identity:69/277 - (24%)
Similarity:107/277 - (38%) Gaps:79/277 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 AVDVVLRVLLVIT---FF----------KLETMTAFKREIHEEELWLYKNPRRPDIVRGGELLFW 123
            ||.|::..||.::   ||          :.:|:||.       :|.||.               .
 Worm    56 AVTVIVPTLLGVSQRGFFCDDDSIRYEYRKDTITAV-------QLMLYN---------------L 98

  Fly   124 VIVAPFLVTIAFYWYTRDRRDFRAASWAW-------------------TLALCMNGIPTSVLKIT 169
            |:.|..::.:.:|...:...:.....:.|                   .:...||.....|.|..
 Worm    99 VLNAATVLFVEYYRMQKVESNINNPRYRWRNNHLHVLFVRLLTYFGYSQIGFVMNIALNIVTKHV 163

  Fly   170 VGRPRPDYFYRCFPDGVMVLNTTSNGVDTS--ILDFNCTGLPGDINEGRKSFPSGHSSFAFASFG 232
            |||.||.:...|     .:.|.|....|:.  |.|:.|||.|..:.|.||||.||||:.:.....
 Worm   164 VGRLRPHFLDVC-----KLANDTCVTGDSHRYITDYTCTGPPELVLEARKSFYSGHSAVSLYCAT 223

  Fly   233 FIAYYIGAKL-HAFDSRGRGHTWRLCIAVIPL------FIALLVAVSRTCDYHHHWQDVTIGGLI 290
            :.|.||.|:| ...::|          .|:|:      .|.|.::.||..|..|||.||.:|..|
 Worm   224 WSALYIQARLGPVLNNR----------IVVPISQTLMFMIGLGISFSRITDNKHHWSDVLVGIFI 278

  Fly   291 GLFAGYISYTQYYPSIF 307
            |:|....:.| ::..:|
 Worm   279 GIFLAVYTCT-FWTDLF 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 57/225 (25%)
plpp-1.2NP_001122646.1 PAP2_wunen 138..287 CDD:239479 50/163 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2488
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X622
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.